Trusted Peptides
Tesamorelin/ Ipamorelin (6mg/2mg)
Tesamorelin/ Ipamorelin (6mg/2mg)
Couldn't load pickup availability
| Chemical Formula: |
Tesamorelin: C223H370N72O69S Ipamorelin: C38H49N9O5 |
| Molecular Weight: |
Tesamorelin: 5195.908 g/mol Ipamorelin: 711.868 g/mol |
| Sequence: |
Tesamorelin: YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL Ipamorelin: Aib-His-D-2Nal-D-Phe-Lys |
| Concentration: | 8mg (1 vial) |
| Physical Form: | White lyophilized powder |
| PubChem: |
Terms
This material is sold for laboratory research use only. Terms of sale apply. Not for human consumption, nor medical, veterinary, or household uses. Please familiarize yourself with our terms and conditions prior to ordering
Additional Information
- Freeze dried powder inside of a sterile 3ml vial.
- Butyl rubber stopper for multiple penetrations while maintaining a secure seal.
- RTF vials are Depyrogenated, and ETO Sterilized.
- Tamper evident aluminum flip top.
Disclaimer
Products are furnished for LABORATORY RESEARCH USE ONLY. This product should only be handled by qualified, and licensed professionals. The product may not be used as a drug, agricultural or pesticidal product, food additive or household chemical – and may not be misbranded as such. All information on this website is available for educational purposes only. Bodily introduction of any kind into humans and/or animals is strictly forbidden by law.
Share
